Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003996 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003996, RRID:AB_1079728
- Product name
- Anti-RAB13
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
AMGIILVYDITDEKSFENIQNWMKSIKENASAGVE
RLLLGNKCDMEAKRKVQKEQADKLAREHGIRFFET
SAKSSMNVDEAFSSLARDILLKSGGRRSGNGNKPP
STDLKTCDKKNTNKCS- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references MICAL-like1 mediates epidermal growth factor receptor endocytosis.
Abou-Zeid N, Pandjaitan R, Sengmanivong L, David V, Le Pavec G, Salamero J, Zahraoui A
Molecular biology of the cell 2011 Sep;22(18):3431-41
Molecular biology of the cell 2011 Sep;22(18):3431-41
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-RAB13 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN