Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000783-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000783-M05, RRID:AB_509344
- Product name
- CACNB2 monoclonal antibody (M05), clone 6C4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CACNB2.
- Antigen sequence
PSSRKSTPPSSAIDIDATGLDAEENDIPANHRSPK
PSANSVTSPHSKEKRMPFFKKTEHTPPYDVVPSMR
PVVLVGPSLKGYEVTDMMQ- Isotype
- IgG
- Antibody clone number
- 6C4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Decrease in the density of t-tubular L-type Ca2+ channel currents in failing ventricular myocytes.
Horiuchi-Hirose M, Kashihara T, Nakada T, Kurebayashi N, Shimojo H, Shibazaki T, Sheng X, Yano S, Hirose M, Hongo M, Sakurai T, Moriizumi T, Ueda H, Yamada M
American journal of physiology. Heart and circulatory physiology 2011 Mar;300(3):H978-88
American journal of physiology. Heart and circulatory physiology 2011 Mar;300(3):H978-88
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CACNB2 monoclonal antibody (M05), clone 6C4. Western Blot analysis of CACNB2 expression in NIH/3T3 ( Cat # L018V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CACNB2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol