Explore
Validate
Learn
ELISAAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010457-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010457-M01, RRID:AB_581690
- Product name
- GPNMB monoclonal antibody (M01), clone 1A8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GPNMB.
- Antigen sequence
RCQKEDANGNIVYEKNCRNEAGLSADPYVYNWTAW
SEDSDGENGTGQSHHNVFPDGKPFPHHPGWRRWNF
IYVFHTLGQYFQKLGRCSVRVSVNTANVTL- Isotype
- IgG
- Antibody clone number
- 1A8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references GPNMB/OA protein increases the invasiveness of human metastatic prostate cancer cell lines DU145 and PC3 through MMP-2 and MMP-9 activity.
Bioinformatic and statistical analysis of the optic nerve head in a primate model of ocular hypertension.
Fiorentini C, Bodei S, Bedussi F, Fragni M, Bonini SA, Simeone C, Zani D, Berruti A, Missale C, Memo M, Spano P, Sigala S
Experimental cell research 2014 Apr 15;323(1):100-11
Experimental cell research 2014 Apr 15;323(1):100-11
Bioinformatic and statistical analysis of the optic nerve head in a primate model of ocular hypertension.
Kompass KS, Agapova OA, Li W, Kaufman PL, Rasmussen CA, Hernandez MR
BMC neuroscience 2008 Sep 26;9:93
BMC neuroscience 2008 Sep 26;9:93
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GPNMB is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
