HPA022136

antibody from Atlas Antibodies

Targeting: SAT2 SSAT2

Antibody data

Submit

Validation data

Product number: HPA022136 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA022136, RRID:AB_1856592
Product name: Anti-SAT2
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: IYVMPEYRGQGIGSKIIKKVAEVALDKGCSQFRLA VLDWNQRAMDLYKALGAQDLTEAEGWHFFCFQGEA TRKLAGK
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SAT2 protein structure - HPA022136 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human adrenal gland and pancreas tissues using Anti-SAT2 antibody. Corresponding SAT2 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human adrenal gland, colon, pancreas and small intestine using Anti-SAT2 antibody HPA022136 (A) shows similar protein distribution across tissues to independent antibody HPA057096 (B).
Antibody #2 product nr: HPA057096
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human adrenal gland shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine using Anti-SAT2 antibody HPA022136.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human colon using Anti-SAT2 antibody HPA022136.
Sample type: HUMAN