HPA002044
antibody from Atlas Antibodies
Targeting: PSMC4
MGC13687, MGC23214, MGC8570, MIP224, S6, TBP-7, TBP7
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002044 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002044, RRID:AB_1079707
- Product name
- Anti-PSMC4
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKE
FLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGST
TGSNYYVRILSTIDRELLKPNASVALHKHSNA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Differential Expression of Novel Tyrosine Kinase Substrates during Breast Cancer Development
Chen Y, Choong L, Lin Q, Philp R, Wong C, Ang B, Tan Y, Loh M, Hew C, Shah N, Druker B, Chong P, Lim Y
Molecular & Cellular Proteomics 2007 September;6(12):2072-2087
Molecular & Cellular Proteomics 2007 September;6(12):2072-2087
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in human cell line A-549.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human gall bladder shows nuclear positivity in glandular cells.
- Sample type
- HUMAN