HPA002465

antibody from Atlas Antibodies

Targeting: KRT19 CK19, K19, K1CS, MGC15366

Antibody data

Submit

Validation data

Product number: HPA002465 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA002465, RRID:AB_1079179
Product name: Anti-KRT19
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: TEELNREVAGHTEQLQMSRSEVTDLRRTLQGLEIE LQSQLSMKAALEDTLAETEARFGAQLAHIQALISG IEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIAT YRSLLEGQEDHYNNLSASKVL
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

KRT19 protein structure - HPA002465 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human urinary bladder and lymph node tissues using HPA002465 antibody. Corresponding KRT19 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows strong membranous positivity in glandular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human urinary bladder shows strong cytoplasmic/membranous positivity in urothelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human small intestine shows moderate cytoplasmic/membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human breast shows moderate cytoplasmic/membranous positivity in glandular cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no positivity as expected.
Sample type: HUMAN