Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00026269-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00026269-M01, RRID:AB_606229
- Product name
- FBXO8 monoclonal antibody (M01), clone 1C11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FBXO8.
- Antigen sequence
MGQGLWRVVRNQQLQQEGYSEQGYLTREQSRRMAA
SNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFIN
LEMLPPE- Isotype
- IgG
- Antibody clone number
- 1C11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged FBXO8 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol