75-297

Targeting: ABCC9 CMD1O, SUR2

Western blot

Immunohistochemistry

Antibody data

Submit

Validation data

Product number: 75-297 - Provider product page
Provider: UC Davis/NIH NeuroMab Facility
Proper citation: UC Davis/NIH NeuroMab Facility Cat#75-297, RRID:AB_2315930
Product name: anti-SUR2B
Antibody type: Monoclonal
Antigen: Recombinant protein
Reactivity: Human, Mouse, Rat
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: amino acids 1503-1545 (VHTILTADLVIV MKRGNILEYDTPESLLAQEDGVFASFVRADM, cy toplasmic C-terminus) of rat SUR2B
Isotype: IgG
Antibody clone number: N323A/51
Vial size: 100 µl
Concentration: 1mg/ml
Storage: Antibodies contain 10mm azide. Store at 4°C or aliquot and store at -20°C. Avoid repeated free-thaw cycles.

ABCC9 protein structure - 75-297 shown in red.