H00023462-M02

HEY1 antibody from Abnova Corporation
bHLHb31, CHF-2, CHF2, HERP2, HESR-1, HESR1, HRT-1

Antibody data

Product number
H00023462-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023462-M02, RRID:AB_626434
Product name
HEY1 monoclonal antibody (M02), clone 2F10
Provider product page
Abnova Corporation - H00023462-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HEY1.
Antigen sequence
DYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLV
SHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHI
AHPLLLPQNGHGNAGTTASPTEPHHQGRLG
Isotype
IgG
Antibody clone number
2F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -