Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183400 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Transient Receptor Potential Cation Channel, Subfamily M, Member 3 (TRPM3) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3
- Reactivity
- Human, Mouse
- Host
- Rabbit
- Antigen sequence
TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINES
LRDQL LVTIQKTFTY- Vial size
- 100 µg
Submitted references Expression of transient receptor potential channel melastin (TRPM) 1-8 and TRPA1 (ankyrin) in mouse inner ear.
Molecular and functional characterization of the melastatin-related cation channel TRPM3.
Takumida M, Ishibashi T, Hamamoto T, Hirakawa K, Anniko M
Acta oto-laryngologica 2009 Oct;129(10):1050-60
Acta oto-laryngologica 2009 Oct;129(10):1050-60
Molecular and functional characterization of the melastatin-related cation channel TRPM3.
Grimm C, Kraft R, Sauerbruch S, Schultz G, Harteneck C
The Journal of biological chemistry 2003 Jun 13;278(24):21493-501
The Journal of biological chemistry 2003 Jun 13;278(24):21493-501
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting