Antibody data

Product number
H00006660-M01
Provider
Abnova Corporation
Product name
SOX5 monoclonal antibody (M01), clone 4H8
Provider product page
Abnova Corporation - H00006660-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SOX5.
Antigen sequence
GSGNFGEIKGTPESLAEKERQLMGMINQLTSLREQ
LLAAHDEQKKLAASQ
Isotype
IgG
Antibody clone number
4H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -