HPA060499

SOX5 antibody from Atlas Antibodies
L-SOX5, MGC35153

Antibody data

Product number
HPA060499
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA060499, RRID:AB_2684294
Product name
Anti-SOX5
Provider product page
Atlas Antibodies - HPA060499
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VEEEESDGLPAFHLPLHVSFPNKPHSEEFQPVSLL
TQETCGHRTPTSQHNTMEVDGNKVMSSFAPHNSST
SPQKAEEGGRQSGESLSSTALG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -