HPA024099

antibody from Atlas Antibodies

Targeting: GDA

Antibody data

Submit

Validation data

Product number: HPA024099 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA024099, RRID:AB_1855594
Product name: Anti-GDA
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NKVNEKSLTLKEVFRLATLGGSQALGLDGEIGNFE VGKEFDAILINPKASDSPIDLFYGDFFGDISEAVI QKFLYLGDDRNIEEVYVGGKQVVPF
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

GDA protein structure - HPA024099 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human kidney and lymph node tissues using Anti-GDA antibody. Corresponding GDA RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, duodenum, kidney and lymph node using Anti-GDA antibody HPA024099 (A) shows similar protein distribution across tissues to independent antibody HPA019352 (B).
Antibody #2 product nr: HPA030387, HPA019352
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate cytoplasmic positivity in tubular cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum using Anti-GDA antibody HPA024099.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-GDA antibody HPA024099.
Sample type: HUMAN