Explore
Validate
Learn
Western blot
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [6]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002866 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002866, RRID:AB_1080092
- Product name
- Anti-SSBP1
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LQVLRQFVRHESETTTSLVLERSLNRVHLLGRVGQ
DPVLRQVEGKNPVTIFSLATNEMWRSGDSEVYQLG
DVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYLE
GKIDYGEYMDKNNVRRQATTIIADNIIFLSDQTKE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Whole cell formaldehyde cross-linking simplifies purification of mitochondrial nucleoids and associated proteins involved in mitochondrial gene expression.
Identification of rep-associated factors in herpes simplex virus type 1-induced adeno-associated virus type 2 replication compartments.
Rajala N, Hensen F, Wessels HJ, Ives D, Gloerich J, Spelbrink JN
PloS one 2015;10(2):e0116726
PloS one 2015;10(2):e0116726
Identification of rep-associated factors in herpes simplex virus type 1-induced adeno-associated virus type 2 replication compartments.
Nicolas A, Alazard-Dany N, Biollay C, Arata L, Jolinon N, Kuhn L, Ferro M, Weller SK, Epstein AL, Salvetti A, Greco A
Journal of virology 2010 Sep;84(17):8871-87
Journal of virology 2010 Sep;84(17):8871-87
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Genetic validation
- Main image
- Experimental details
- Western blot analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SSBP1 antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and pancreas tissues using HPA002866 antibody. Corresponding SSBP1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human esophagus shows granular cytoplasmic positivity in squamous epithelial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows weak granular cytoplasmic positivity in exocrine glandular cells.
- Sample type
- HUMAN
