Antibody data

Product number
ABIN1109588
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 426 (ZNF426) (N-Term) antibody
Provider product page
antibodies-online - ABIN1109588
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF426 antibody: synthetic peptide directed towards the N terminal of human ZNF426
Description
Purified using peptide immunoaffinity column
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQG
GVLQGWEMRLETQWS
Epitope
N-Term
Vial size
50 μg
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Handling
Avoid repeated freezing and thawing.