AV33566

ZNF426 antibody from MilliporeSigma / Merck KGaA
MGC2663
No application information provided.

Antibody data

Product number
AV33566
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-ZNF426 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV33566
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF426 with an internal ID of P04621
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LENYKNLATVGGQIIKPSLISWLEQEESRTVQGGV
LQGWEMRLETQWSIL
Storage
-20C