Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00004724-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00004724-M01, RRID:AB_518942
- Product name
- NDUFS4 monoclonal antibody (M01), clone 1A1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant NDUFS4.
- Antigen sequence
GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKME
FDTRERWENPLMGWASTADPLSNMVLTFSTKEDAV
SFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRT
RVSTK- Isotype
- IgG
- Antibody clone number
- 1A1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- NDUFS4 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NDUFS4 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of NDUFS4 expression in transfected 293T cell line by NDUFS4 monoclonal antibody (M01), clone 1A1.Lane 1: NDUFS4 transfected lysate(20.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged NDUFS4 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to NDUFS4 on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
