Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA027175 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA027175, RRID:AB_1853591
- Product name
- Anti-MASTL
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TSQLGFHQSNQWAVDSGGISEEHLGKRSLKRNFEL
VDSSPCKKIIQNKKTCVEYKHNEMTNCYTNQNTGL
TVEVQDLKLSVHKSQQNDCANKEN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references PP2A/B55 and Fcp1 regulate Greatwall and Ensa dephosphorylation during mitotic exit.
Hégarat N, Vesely C, Vinod PK, Ocasio C, Peter N, Gannon J, Oliver AW, Novák B, Hochegger H
PLoS genetics 2014 Jan;10(1):e1004004
PLoS genetics 2014 Jan;10(1):e1004004
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and mASTL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY403204).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity in subsets of cells.
- Sample type
- HUMAN