WH0063974M6

NEUROD6 antibody from Sigma-Aldrich
Atoh2, bHLHa2, Math-2, Nex1, NEX1M
ELISA
Recommended by provider

Antibody data

Product number
WH0063974M6
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0063974M6, RRID:AB_1842646
Product name
Monoclonal Anti-NEUROD6 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0063974M6
Antibody type
Monoclonal
Antigen
NEUROD6 (NP_073565, a.a. 191-290) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTL
DNSKSMKPYNYCSAYESFYESTSPECASPQFEGPL
SPPPINYNGIFSLKQEETLDYGKNYNYGMH (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -