H00063974-M06

NEUROD6 antibody from Abnova Corporation
Atoh2, bHLHa2, Math-2, Nex1, NEX1M

Antibody data

Product number
H00063974-M06
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063974-M06, RRID:AB_894205
Product name
NEUROD6 monoclonal antibody (M06), clone 3B3
Provider product page
Abnova Corporation - H00063974-M06
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant NEUROD6.
Antigen sequence
GQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTL
DNSKSMKPYNYCSAYESFYESTSPECASPQFEGPL
SPPPINYNGIFSLKQEETLDYGKNYNYGMH
Isotype
IgG
Antibody clone number
3B3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -