H00063974-M17

NEUROD6 antibody from Abnova Corporation
Atoh2, bHLHa2, Math-2, Nex1, NEX1M

Antibody data

Product number
H00063974-M17
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00063974-M17, RRID:AB_1577675
Product name
NEUROD6 monoclonal antibody (M17), clone 3G7
Provider product page
Abnova Corporation - H00063974-M17
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant NEUROD6.
Antigen sequence
STSPECASPQFEGPLSPPPINYNGIFSLKQEETLD
YGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFP
YDLHLRSQSLTMQDELNAVFHN
Isotype
IgG
Antibody clone number
3G7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -