HPA074530

NEUROD6 antibody from Atlas Antibodies
Atoh2, bHLHa2, Math-2, Nex1, NEX1M

Antibody data

Product number
HPA074530
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA074530, RRID:AB_2732257
Product name
Anti-NEUROD6
Provider product page
Atlas Antibodies - HPA074530
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AGCLQLNARSFLMGQGGEAAHHTRSPYSTFYPPYH
SPELTTPPGHGTLDNSKS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -