AV32416

NEUROD6 antibody from Sigma-Aldrich
Atoh2, bHLHa2, Math-2, Nex1, NEX1M
No application information provided.

Antibody data

Product number
AV32416
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV32416, RRID:AB_1854395
Product name
Anti-NEUROD6 (AB1) antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV32416
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human NEUROD6 with an internal ID of P03411
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SFSKQIVLRGKSIKRAPGEETEKEEEEEDREEEDE
NGLPRRRGLRKKKTT
Storage
-20C
Provider Type Product Number
- No reagents -