Explore
Validate
LearnHPA003405
antibody from Atlas Antibodies
Targeting: IVNS1ABP
ARA3, HSPC068, KIAA0850, KLHL39, ND1, NS-1, NS1-BP
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA003405 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA003405, RRID:AB_1079141
- Product name
- Anti-IVNS1ABP
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
QDELIEKPMSPMQYARSGLGTAEMNGKLIAAGGYN
REECLRTVECYNPHTDHWSFLAPMRTPRARFQMAV
LMGQLYVVGGSNGHSDDLSCGEMYDSNIDDWIPVP
ELRTNRCNAGVCALNGKLYIVGGSD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Profiling of Atherosclerotic Lesions by Gene and Tissue Microarrays Reveals PCSK6 as a Novel Protease in Unstable Carotid Atherosclerosis
Perisic L, Hedin E, Razuvaev A, Lengquist M, Osterholm C, Folkersen L, Gillgren P, Paulsson-Berne G, Ponten F, Odeberg J, Hedin U
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 September;33(10):2432-2443
Arteriosclerosis, Thrombosis, and Vascular Biology 2013 September;33(10):2432-2443
No comments: Submit comment
Supportive validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines U-251MG and PC-3 using Anti-IVNS1ABP antibody. Corresponding IVNS1ABP RNA-seq data are presented for the same cell lines. Loading control: Anti-PARP1.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Recombinant expression validation
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and IVNS1ABP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY416621).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
