ABIN310260
antibody from antibodies-online
Targeting: MPPED2
239FB, C11orf8, D11S302E, dJ1024C24.1, dJ873F21.1, FAM1B, Hs.46638
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310260 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-metallophosphoesterase Domain Containing 2 (MPPED2) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MPPED2 antibody: synthetic peptide directed towards the C terminal of human MPPED2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQP
TNPPI IFDLPNPQGS- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The 239AB gene on chromosome 22: a novel member of an ancient gene family.
Direct hypoglossal nerve stimulation in obstructive sleep apnea.
Schwartz F, Ota T
Gene 1997 Jul 18;194(1):57-62
Gene 1997 Jul 18;194(1):57-62
Direct hypoglossal nerve stimulation in obstructive sleep apnea.
Eisele DW, Smith PL, Alam DS, Schwartz AR
Archives of otolaryngology--head & neck surgery 1997 Jan;123(1):57-61
Archives of otolaryngology--head & neck surgery 1997 Jan;123(1):57-61
No comments: Submit comment
No validations: Submit validation data