Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001015-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001015-M03, RRID:AB_1111723
- Product name
- CDH17 monoclonal antibody (M03), clone 3H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CDH17.
- Antigen sequence
EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAV
TFELTGETDNIFVIEREGLLYYNRALDRETRSTHN
LQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQ
SKY- Isotype
- IgG
- Antibody clone number
- 3H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The contribution of cell phenotype to the behavior of gastric cancer.
Solcia E, Klersy C, Vanoli A, Grillo F, Manca R, Tava F, Luinetti O, Fiocca R
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association 2013 Oct;16(4):462-71
Gastric cancer : official journal of the International Gastric Cancer Association and the Japanese Gastric Cancer Association 2013 Oct;16(4):462-71
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CDH17 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CDH17 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol