HPA025762

antibody from Atlas Antibodies

Targeting: ACOT7 ACH1, ACT, BACH, CTE-II, hBACH, LACH1, MGC1126

Antibody data

Submit

Validation data

Product number: HPA025762 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA025762, RRID:AB_1844524
Product name: Anti-ACOT7
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSL SQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKA KRQGH
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

ACOT7 protein structure - HPA025762 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using HPA025762 antibody. Corresponding ACOT7 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-ACOT7 antibody HPA025762 (A) shows similar protein distribution across tissues to independent antibody HPA025735 (B).
Antibody #2 product nr: HPA025735
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex shows strong positivity in neurons and neuropil.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows weak to no positivity in exocrine glandular cells as expected.
Sample type: HUMAN