Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182379 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Kruppel-Like Factor 8 (KLF8) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KLF8 antibody: synthetic peptide directed towards the N terminal of human KLF8
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
LSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVS
TSTSD MSTSANIPTV- Vial size
- 50 µg
Submitted references Krüppel‑like factor expression and correlation with FAK, MMP‑9 and E‑cadherin expression in hepatocellular carcinoma.
Up-regulation of Krüppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma.
Small interference RNA targeting Krüppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo.
Abnormal expression of the KLF8 (ZNF741) gene in a female patient with an X;autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
Han S, Han L, Sun H, Zan X, Zhou Z, Xu K, Yao Y, Liu Q
Molecular medicine reports 2013 Jul;8(1):81-8
Molecular medicine reports 2013 Jul;8(1):81-8
Up-regulation of Krüppel-like factor 8 promotes tumor invasion and indicates poor prognosis for hepatocellular carcinoma.
Li JC, Yang XR, Sun HX, Xu Y, Zhou J, Qiu SJ, Ke AW, Cui YH, Wang ZJ, Wang WM, Liu KD, Fan J
Gastroenterology 2010 Dec;139(6):2146-2157.e12
Gastroenterology 2010 Dec;139(6):2146-2157.e12
Small interference RNA targeting Krüppel-like factor 8 inhibits the renal carcinoma 786-0 cells growth in vitro and in vivo.
Fu WJ, Li JC, Wu XY, Yang ZB, Mo ZN, Huang JW, Xia GW, Ding Q, Liu KD, Zhu HG
Journal of cancer research and clinical oncology 2010 Aug;136(8):1255-65
Journal of cancer research and clinical oncology 2010 Aug;136(8):1255-65
Abnormal expression of the KLF8 (ZNF741) gene in a female patient with an X;autosome translocation t(X;21)(p11.2;q22.3) and non-syndromic mental retardation.
Lossi AM, Laugier-Anfossi F, Depetris D, Gecz J, Gedeon A, Kooy F, Schwartz C, Mattei MG, Croquette MF, Villard L
Journal of medical genetics 2002 Feb;39(2):113-7
Journal of medical genetics 2002 Feb;39(2):113-7
No comments: Submit comment
No validations: Submit validation data