Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA019155 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA019155, RRID:AB_1857565
- Product name
- Anti-STAU2
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
LQINQMFSVQLSLGEQTWESEGSSIKKAQQAVANK
ALTESTLPKPVQKPPKSNVNNNPGSITPTVELNGL
AMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRY
HCPVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAM
KALQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
Gleghorn ML, Gong C, Kielkopf CL, Maquat LE
Nature structural & molecular biology 2013 Apr;20(4):515-24
Nature structural & molecular biology 2013 Apr;20(4):515-24
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows cytoplasmic and nucleolar positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cell bodies and processes.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN