Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079977-A01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079977-A01, RRID:AB_535386
- Product name
- GRHL2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant GRHL2.
- Antigen sequence
- ENRVQVLKTVPVNLSLNQDHLENSKREQYSISFPE
 SSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGE
 EQRVVIFEQTQYDVPSLATHSAYLKDDQRS
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Dual roles of the transcription factor grainyhead-like 2 (GRHL2) in breast cancer.
				
Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism.
				
Grainyhead-like 2 enhances the human telomerase reverse transcriptase gene expression by inhibiting DNA methylation at the 5'-CpG island in normal human keratinocytes.
				
Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.
				
		
	
			Werner S, Frey S, Riethdorf S, Schulze C, Alawi M, Kling L, Vafaizadeh V, Sauter G, Terracciano L, Schumacher U, Pantel K, Assmann V
The Journal of biological chemistry 2013 Aug 9;288(32):22993-3008
		The Journal of biological chemistry 2013 Aug 9;288(32):22993-3008
Grainyhead-like 2 (GRHL2) inhibits keratinocyte differentiation through epigenetic mechanism.
			Chen W, Xiao Liu Z, Oh JE, Shin KH, Kim RH, Jiang M, Park NH, Kang MK
Cell death & disease 2012 Dec 20;3:e450
		Cell death & disease 2012 Dec 20;3:e450
Grainyhead-like 2 enhances the human telomerase reverse transcriptase gene expression by inhibiting DNA methylation at the 5'-CpG island in normal human keratinocytes.
			Chen W, Dong Q, Shin KH, Kim RH, Oh JE, Park NH, Kang MK
The Journal of biological chemistry 2010 Dec 24;285(52):40852-63
		The Journal of biological chemistry 2010 Dec 24;285(52):40852-63
Regulation of the hTERT promoter activity by MSH2, the hnRNPs K and D, and GRHL2 in human oral squamous cell carcinoma cells.
			Kang X, Chen W, Kim RH, Kang MK, Park NH
Oncogene 2009 Jan 29;28(4):565-74
		Oncogene 2009 Jan 29;28(4):565-74
				No comments: Submit comment	
	
			
			No validations: Submit validation data