Antibody data
- Antibody Data
- Antigen structure
- References [7]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [7]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004820 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004820, RRID:AB_1857928
- Product name
- Anti-GRHL2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NRVQVLKTVPVNLSLNQDHLENSKREQYSISFPES
SAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEE
QRVVIFEQTQYDVPSLATHSAYLKDDQRSTPDSTY
SESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYT
LEATKSLRQK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Grainyhead-like 2 Promotes Tumor Growth and is Associated with Poor Prognosis in Colorectal Cancer.
Expression of transcription factor grainyhead-like 2 is diminished in cervical cancer.
Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis.
Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1.
Epithelial-mesenchymal transition and tumor suppression are controlled by a reciprocal feedback loop between ZEB1 and Grainyhead-like-2.
Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium
The transcription factors Grainyhead-like 2 and NK2-homeobox 1 form a regulatory loop that coordinates lung epithelial cell morphogenesis and differentiation.
Quan Y, Xu M, Cui P, Ye M, Zhuang B, Min Z
Journal of Cancer 2015;6(4):342-50
Journal of Cancer 2015;6(4):342-50
Expression of transcription factor grainyhead-like 2 is diminished in cervical cancer.
Torres-Reyes LA, Alvarado-Ruiz L, Piña-Sánchez P, Martínez-Silva MG, Ramos-Solano M, Olimón-Andalón V, Ortiz-Lazareno PC, Hernández-Flores G, Bravo-Cuellar A, Aguilar-Lemarroy A, Jave-Suarez LF
International journal of clinical and experimental pathology 2014;7(11):7409-18
International journal of clinical and experimental pathology 2014;7(11):7409-18
Grainyhead-like 2 (GRHL2) distribution reveals novel pathophysiological differences between human idiopathic pulmonary fibrosis and mouse models of pulmonary fibrosis.
Varma S, Mahavadi P, Sasikumar S, Cushing L, Hyland T, Rosser AE, Riccardi D, Lu J, Kalin TV, Kalinichenko VV, Guenther A, Ramirez MI, Pardo A, Selman M, Warburton D
American journal of physiology. Lung cellular and molecular physiology 2014 Mar 1;306(5):L405-19
American journal of physiology. Lung cellular and molecular physiology 2014 Mar 1;306(5):L405-19
Downregulation of GRHL2 inhibits the proliferation of colorectal cancer cells by targeting ZEB1.
Quan Y, Jin R, Huang A, Zhao H, Feng B, Zang L, Zheng M
Cancer biology & therapy 2014 Jul;15(7):878-87
Cancer biology & therapy 2014 Jul;15(7):878-87
Epithelial-mesenchymal transition and tumor suppression are controlled by a reciprocal feedback loop between ZEB1 and Grainyhead-like-2.
Cieply B, Farris J, Denvir J, Ford HL, Frisch SM
Cancer research 2013 Oct 15;73(20):6299-309
Cancer research 2013 Oct 15;73(20):6299-309
Evidence for multiple roles for grainyhead-like 2 in the establishment and maintenance of human mucociliary airway epithelium
Gao X, Vockley C, Pauli F, Newberry K, Xue Y, Randell S, Reddy T, Hogan B
Proceedings of the National Academy of Sciences 2013 June;110(23):9356-9361
Proceedings of the National Academy of Sciences 2013 June;110(23):9356-9361
The transcription factors Grainyhead-like 2 and NK2-homeobox 1 form a regulatory loop that coordinates lung epithelial cell morphogenesis and differentiation.
Varma S, Cao Y, Tagne JB, Lakshminarayanan M, Li J, Friedman TB, Morell RJ, Warburton D, Kotton DN, Ramirez MI
The Journal of biological chemistry 2012 Oct 26;287(44):37282-95
The Journal of biological chemistry 2012 Oct 26;287(44):37282-95
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis in control (vector only transfected HEK293T lysate) and gRHL2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY411012).
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human prostate and liver tissues using HPA004820 antibody. Corresponding GRHL2 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows strong nuclear positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows no positivity as expected.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human skin shows strong nuclear positivity in squamous epithelial cells.
- Sample type
- HUMAN