Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00006119-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00006119-M01, RRID:AB_464362
- Product name
- RPA3 monoclonal antibody (M01), clone 1F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RPA3.
- Antigen sequence
INAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDG
EGKNGTIELMEPLDEEISGIVEVVGRVTAKATILC
TSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
IVQHD- Isotype
- IgG
- Antibody clone number
- 1F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RPA3 monoclonal antibody (M01), clone 1F4 Western Blot analysis of RPA3 expression in HL-60 ( Cat # L014V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RPA3 expression in transfected 293T cell line by RPA3 monoclonal antibody (M01), clone 1F4.Lane 1: RPA3 transfected lysate(13.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to RPA3 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol