PAB20255

ZNF384 antibody from Abnova Corporation
CAGH1A, CIZ, NMP4, NP, TNRC1

Antibody data

Product number
PAB20255
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20255, RRID:AB_10983860
Product name
ZNF384 polyclonal antibody
Provider product page
Abnova Corporation - PAB20255
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF384.
Antigen sequence
SHFNSNPYFWPSIPTVSGQIENTMFINKMKDQLLP
EKGCGLAPPHYPTLLTVPASVSLPSGISMDTESKS
DQLTPHSQASVTQNITVVPVPSTGLMTA
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -