Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00005756-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00005756-M02, RRID:AB_534998
- Product name
- PTK9 monoclonal antibody (M02), clone 1E2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PTK9.
- Antigen sequence
VAFPISREAFQALEKLNNRQLNYVQLEIDIKNEII
ILANTTNTELKDLPKRIPKDSARYHFFLYKHSHEG
DYLESIVFIYSMPGYTCSIRERMLYSSCKSRLLEI
VERQLQMDVIRKIEIDNGDELTADFLYEEVHPKQH
AHKQSSAKPKGPAGKRGIRRLIRGPAETEATTD- Isotype
- IgG
- Antibody clone number
- 1E2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Genomic profiling of microRNA and messenger RNA reveals deregulated microRNA expression in prostate cancer.
Ambs S, Prueitt RL, Yi M, Hudson RS, Howe TM, Petrocca F, Wallace TA, Liu CG, Volinia S, Calin GA, Yfantis HG, Stephens RM, Croce CM
Cancer research 2008 Aug 1;68(15):6162-70
Cancer research 2008 Aug 1;68(15):6162-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PTK9 monoclonal antibody (M02), clone 1E2 Western Blot analysis of PTK9 expression in HeLa ( Cat # L013V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PTK9 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of TWF1 transfected lysate using anti-TWF1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with TWF1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to PTK9 on formalin-fixed paraffin-embedded human ovary. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol