Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009960-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009960-M01, RRID:AB_566265
- Product name
- USP3 monoclonal antibody (M01), clone 1H2
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant USP3.
- Antigen sequence
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYD
LAAVVVHHGSGVGSGHYTAYATHEGRWFHFNDSTV
TLTDEETVVKAKAYILFYVEHQAKAGSDKL- Isotype
- IgG
- Antibody clone number
- 1H2
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The deubiquitylating enzyme USP44 counteracts the DNA double-strand break response mediated by the RNF8 and RNF168 ubiquitin ligases.
Mosbech A, Lukas C, Bekker-Jensen S, Mailand N
The Journal of biological chemistry 2013 Jun 7;288(23):16579-16587
The Journal of biological chemistry 2013 Jun 7;288(23):16579-16587
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of USP3 expression in transfected 293T cell line by USP3 monoclonal antibody (M01), clone 1H2.Lane 1: USP3 transfected lysate(58.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged USP3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to USP3 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
