Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00053944-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00053944-M01, RRID:AB_534828
- Product name
- CSNK1G1 monoclonal antibody (M01), clone 3D1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CSNK1G1.
- Antigen sequence
KKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITR
ESHTHRDRPSQQQPLRNQVVSSTNGELNVDDPTGA
HSNAPITAHAEVEVVEEAKCCCFFKRKRKKT- Isotype
- IgG
- Antibody clone number
- 3D1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- CSNK1G1 monoclonal antibody (M01), clone 3D1 Western Blot analysis of CSNK1G1 expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of CSNK1G1 expression in transfected 293T cell line by CSNK1G1 monoclonal antibody (M01), clone 3D1.Lane 1: CSNK1G1 transfected lysate(45.4 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged CSNK1G1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoperoxidase of monoclonal antibody to CSNK1G1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol
