Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [5]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA004823 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA004823, RRID:AB_1080243
- Product name
- Anti-TNC
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
RLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTAL
DGPSGLVTANITDSEALARWQPAIATVDSYVISYT
GEKVPEITRTVSGNTVEYALTDLEPATEYTLRIFA
EKGPQKSSTITAKFTTDLDSPRDLTATEV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The co-expression of MMP-9 and Tenascin-C is significantly associated with the progression and prognosis of pancreatic cancer.
Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells.
Cardiomyopathy is associated with structural remodelling of heart valve extracellular matrix.
Xu Y, Li Z, Jiang P, Wu G, Chen K, Zhang X, Li X
Diagnostic pathology 2015 Dec 10;10:211
Diagnostic pathology 2015 Dec 10;10:211
Extracellular Hsp90 mediates an NF-κB dependent inflammatory stromal program: implications for the prostate tumor microenvironment.
Bohonowych JE, Hance MW, Nolan KD, Defee M, Parsons CH, Isaacs JS
The Prostate 2014 Apr;74(4):395-407
The Prostate 2014 Apr;74(4):395-407
CD99 is a novel prognostic stromal marker in non-small cell lung cancer
Edlund K, Lindskog C, Saito A, Berglund A, Pontén F, Göransson-Kultima H, Isaksson A, Jirström K, Planck M, Johansson L, Lambe M, Holmberg L, Nyberg F, Ekman S, Bergqvist M, Landelius P, Lamberg K, Botling J, Östman A, Micke P
International Journal of Cancer 2012 November;131(10):2264-2273
International Journal of Cancer 2012 November;131(10):2264-2273
Dissecting the oncogenic and tumorigenic potential of differentiated human induced pluripotent stem cells and human embryonic stem cells.
Ghosh Z, Huang M, Hu S, Wilson KD, Dey D, Wu JC
Cancer research 2011 Jul 15;71(14):5030-9
Cancer research 2011 Jul 15;71(14):5030-9
Cardiomyopathy is associated with structural remodelling of heart valve extracellular matrix.
Schenke-Layland K, Stock UA, Nsair A, Xie J, Angelis E, Fonseca CG, Larbig R, Mahajan A, Shivkumar K, Fishbein MC, MacLellan WR
European heart journal 2009 Sep;30(18):2254-65
European heart journal 2009 Sep;30(18):2254-65
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows distinct positivity in neuropil.
- Sample type
- HUMAN
