Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb90834 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb90834, RRID:AB_2665683
- Product name
- Anti-AKT1
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMD
FRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLK
LLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA- Epitope
- Binds to an epitope located within the peptide sequence FEYLKLLGKGTFGKV as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL0887
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Lane 1: Marker [kDa]Lane 2: Human cell line RT-4
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of MCF7 cells using the Anti-AKT1 monoclonal antibody, showing specific staining in the nucleus, cytosol and plasma membrane in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
- Sample type
- HUMAN