WH0008667M1

EIF3H antibody from MilliporeSigma / Merck KGaA
eIF3-gamma, eIF3-p40, eIF3h, EIF3S3
ELISA
Recommended by provider

Antibody data

Product number
WH0008667M1
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#WH0008667M1, RRID:AB_1841434
Product name
Monoclonal Anti-EIF3S3 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - WH0008667M1
Antibody type
Monoclonal
Antigen
EIF3S3 (NP_003747, a.a. 152-251) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
YDPIKTAQGSLSLKAYRLTPKLMEVCKEKDFSPEA
LKKANITFEYMFEEVPIVIKNSHLINVLMWELEKK
SAVADKHELLSLASSNHLGKNLQLLMDRV* (wit
hout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -