Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN404996 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Zebrafish
- Host
- Rabbit
- Antigen sequence
KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRK
FLQAI HQLRSVKMEQ- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimer's disease mice.
Cell-cycle-dependent regulation of Ca2+-activated K+ channel in Jurkat T-lymphocyte.
Chakroborty S, Kim J, Schneider C, Jacobson C, Molgó J, Stutzmann GE
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Jun 13;32(24):8341-53
The Journal of neuroscience : the official journal of the Society for Neuroscience 2012 Jun 13;32(24):8341-53
Cell-cycle-dependent regulation of Ca2+-activated K+ channel in Jurkat T-lymphocyte.
Morimoto T, Ohya S, Hayashi H, Onozaki K, Imaizumi Y
Journal of pharmacological sciences 2007 May;104(1):94-8
Journal of pharmacological sciences 2007 May;104(1):94-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Immunohistochemistry
