AMAb91116

antibody from Atlas Antibodies

Targeting: SLC6A2 NAT1, NET, NET1, SLC6A5

Antibody data

Submit

Validation data

Product number: AMAb91116 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#AMAb91116, RRID:AB_2665806
Product name: Anti-NET
Antibody type: Monoclonal
Reactivity: Human, Mouse, Rat
Host: Mouse
Conjugate: Unconjugated
Antigen sequence: SLYYLFSSFTLNLPWTDCGHTWNSPNCTDPKLLNG SVLGNHTKYSKYKFTPAAEFYERGVLHLHESSGIH DI
Epitope: Binds to an epitope located within the peptide sequence HTKYSKYKFTPAAEF as determined by overlapping synthetic peptides.
Isotype: IgG
Antibody clone number: CL3063
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SLC6A2 protein structure - AMAb91116 shown in red.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of rat locus coeruleus shows strong immunoreactivity in noradrenaline neurons and fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse cerebral cortex shows positivity in noradrenergic fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong immunoreactivity in sympathetic fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of rat cerebral cortex shows positivity in noradrenergic fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of mouse hippocampal formation shows immunoreactivity in noradrenergic fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human locus coeruleus shows strong cytoplasmic positivity in monoaminergic neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows absence of immunoreactivity (negative control).

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of rat pons shows strong positivity in noradrenalne neurons in the locus coeruleus.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of rat cerebellum shows strong positivity in noradrenergic fibers.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse brain shows strong positivity in noradrenergic fibers in the cerebral cortex.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunofluorescence staining of mouse brain shows strong positivity in noradrenergic fibers in the hippocampus.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human locus coeruleus shows strong cytoplasmic positivity in noradrenaline neurons.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human prostate shows strong positivity in sympathetic peripheral nerves.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney shows no positivity in cells in tubules or glomeruli as expected.