HPA050217

AIP antibody from Atlas Antibodies
ARA9, FKBP16, XAP2

Antibody data

Product number
HPA050217
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA050217, RRID:AB_2681055
Product name
Anti-AIP
Provider product page
Atlas Antibodies - HPA050217
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MTDEEKAKAVPLIHQEGNRLYREGHVKEAAAKYYD
AIACLKNLQMKEQPGSPEWIQLDKQITPLLLNYCQ
CKLVVEEYYEVLDHCSSILNKYDDNVKAYFKRGKA
HAAVWNAQEAQADFAKVLELDPALAPVVSRELQAL
E
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -