AV35710

AIP antibody from MilliporeSigma / Merck KGaA
ARA9, FKBP16, XAP2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35710
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#AV35710, RRID:AB_1844665
Product name
Anti-AIP (AB1) antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - AV35710
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human AIP with an internal ID of P23554
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
VWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLR
NIAVGKDPLEGQRHC
Storage
-20C
Provider Type Product Number
- No reagents -