Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008723-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008723-M01, RRID:AB_464367
- Product name
- SNX4 monoclonal antibody (M01), clone 4H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant SNX4.
- Antigen sequence
QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARI
KVLEEQINEGEQQLKSKNLEGREFVKNAWADIERF
KEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKE
CFSKM- Isotype
- IgG
- Antibody clone number
- 4H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references SNX4 coordinates endosomal sorting of TfnR with dynein-mediated transport into the endocytic recycling compartment.
Traer CJ, Rutherford AC, Palmer KJ, Wassmer T, Oakley J, Attar N, Carlton JG, Kremerskothen J, Stephens DJ, Cullen PJ
Nature cell biology 2007 Dec;9(12):1370-80
Nature cell biology 2007 Dec;9(12):1370-80
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- SNX4 monoclonal antibody (M01), clone 4H8 Western Blot analysis of SNX4 expression in A-431 ( Cat # L015V1 ).