Antibody data

Product number
H00008723-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008723-M01, RRID:AB_464367
Product name
SNX4 monoclonal antibody (M01), clone 4H8
Provider product page
Abnova Corporation - H00008723-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SNX4.
Antigen sequence
QCEELVTGTVRTFSLKGMTTKLFGQETPEQREARI
KVLEEQINEGEQQLKSKNLEGREFVKNAWADIERF
KEQKNRDLKEALISYAVMQISMCKKGIQVWTNAKE
CFSKM
Isotype
IgG
Antibody clone number
4H8
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -