Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051132-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051132-M01, RRID:AB_606936
- Product name
- RNF12 monoclonal antibody (M01), clone 1G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RNF12.
- Antigen sequence
MENSDSNDKGSGDQSAAQRRSQMDRLDREEAFYQF
VNNLSEEDYRLMRDNNLLGTPGESTEEELLRRLQQ
IKEGPPPQNSDEN- Isotype
- IgG
- Antibody clone number
- 1G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The role of maternal-specific H3K9me3 modification in establishing imprinted X-chromosome inactivation and embryogenesis in mice.
Nuclear receptor NR4A1 promotes breast cancer invasion and metastasis by activating TGF-β signalling.
Fukuda A, Tomikawa J, Miura T, Hata K, Nakabayashi K, Eggan K, Akutsu H, Umezawa A
Nature communications 2014 Nov 14;5:5464
Nature communications 2014 Nov 14;5:5464
Nuclear receptor NR4A1 promotes breast cancer invasion and metastasis by activating TGF-β signalling.
Zhou F, Drabsch Y, Dekker TJ, de Vinuesa AG, Li Y, Hawinkels LJ, Sheppard KA, Goumans MJ, Luwor RB, de Vries CJ, Mesker WE, Tollenaar RA, Devilee P, Lu CX, Zhu H, Zhang L, Dijke PT
Nature communications 2014 Mar 3;5:3388
Nature communications 2014 Mar 3;5:3388
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RNF12 expression in transfected 293T cell line by RNF12 monoclonal antibody (M01), clone 1G10.Lane 1: RNF12 transfected lysate (Predicted MW: 68.5 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- RNF12 monoclonal antibody (M01), clone 1G10. Western Blot analysis of RNF12 expression in Hela S3 NE.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged RNF12 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RNF12 on HeLa cell. [antibody concentration 30 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of RNF12 transfected lysate using anti-RNF12 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with RNF12 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
