Antibody data

Product number
H00000759-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000759-M02, RRID:AB_489781
Product name
CA1 monoclonal antibody (M02), clone M2
Provider product page
Abnova Corporation - H00000759-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full length recombinant CA1.
Antigen sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIK
TSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN
FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHG
SEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD
GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRA
PFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW
IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHN
NRPTQPLKGRTVRASF
Isotype
IgG
Antibody clone number
M2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -