WH0000759M2

CA1 antibody from Sigma-Aldrich
Car1
ELISA
Recommended by provider

Antibody data

Product number
WH0000759M2
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0000759M2, RRID:AB_1840459
Product name
Monoclonal Anti-CA1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0000759M2
Antibody type
Monoclonal
Antigen
CA1 (AAH27890, a.a. 1-262) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIK
TSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN
FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHG
SEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD
GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRA
PFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW
IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHN
NRPTQPLKGR (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -