Antibody data

Product number
H00008654-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008654-M01, RRID:AB_464136
Product name
PDE5A monoclonal antibody (M01), clone 9H5
Provider product page
Abnova Corporation - H00008654-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PDE5A.
Antigen sequence
SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH
TIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPT
RKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQ
MPLTP
Isotype
IgG
Antibody clone number
9H5
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -