Antibody data

Product number
H00008654-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008654-M02, RRID:AB_10554015
Product name
PDE5A monoclonal antibody (M02), clone 1F11
Provider product page
Abnova Corporation - H00008654-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PDE5A.
Antigen sequence
SVEAWLDDHWDFTFSYFVRKATREMVNAWFAERVH
TIPVCKEGIRGHTESCSCPLQQSPRADNSVPGTPT
RKISASEFDRPLRPIVVKDSEGTVSFLSDSEKKEQ
MPLTP
Isotype
IgG
Antibody clone number
1F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -