HPA058376

antibody from Atlas Antibodies

Targeting: SETD1A KIAA0339, KMT2F, Set1

Antibody data

Submit

Validation data

Product number: HPA058376 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA058376, RRID:AB_2683695
Product name: Anti-SETD1A
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: SQFRSSDANYPAYYESWNRYQRHTSYPPRRATREE PPGAPFAENTAERFPPSYTSYLPPEPSRPTDQDYR PPASEA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

SETD1A protein structure - HPA058376 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human testis and pancreas tissues using Anti-SETD1A antibody. Corresponding SETD1A RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, kidney, pancreas and testis using Anti-SETD1A antibody HPA058376 (A) shows similar protein distribution across tissues to independent antibody HPA020646 (B).
Antibody #2 product nr: HPA020646
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows strong nuclear positivity in cells in cells in spermatogonia.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human testis shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human pancreas shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-SETD1A antibody HPA058376.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-SETD1A antibody HPA058376.
Sample type: HUMAN